PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3821s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27343.5 Da    PI: 9.9057
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3821s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.3e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         kri+n++ rqvtfskRr g+lKKA+ELS+LCdaev viifsstgkly+y+s
  Cagra.3821s0004.1.p  9 KRIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDYAS 59
                         79***********************************************86 PP

2K-box83.83.6e-2882171998
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          +++++ + +q+e+a L+++++ Lq+ +R+l+Ge+L+ ++ ++Lq+Le+qL +slk +R kK++l++++i+el +k + +q+en++L++++
  Cagra.3821s0004.1.p  82 NHASEIKFWQREVASLQQQLQYLQECHRKLVGEELSGMNANDLQNLEDQLVTSLKGVRLKKDQLMTDEIRELNRKGQIIQKENQELQNMV 171
                          688999********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.791161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-32292IPR002100Transcription factor, MADS-box
CDDcd002652.20E-42279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014869.1E-2583171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.1687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007584Biological Processresponse to nutrient
GO:0048527Biological Processlateral root development
GO:0071249Biological Processcellular response to nitrate
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIVIKR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVIIFSS TGKLYDYASN  60
SSMKTIIERY NKVKEEQHQL LNHASEIKFW QREVASLQQQ LQYLQECHRK LVGEELSGMN  120
ANDLQNLEDQ LVTSLKGVRL KKDQLMTDEI RELNRKGQII QKENQELQNM VDIMRKENFK  180
LQKKCQQVHG RTSEIEGNSS LDPISNIGTE RCAPPPQLQL IQIQPPREKT IKLGLQLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-18275173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-18275173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-18275173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-18275173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S5e-18175174Myocyte-specific enhancer factor 2B
1tqe_R5e-18175174Myocyte-specific enhancer factor 2B
1tqe_Q5e-18175174Myocyte-specific enhancer factor 2B
1tqe_P5e-18175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2282440.0AK228244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-69-G23.
GenBankBT0058610.0BT005861.1 Arabidopsis thaliana At2g14210 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299776.11e-161hypothetical protein CARUB_v10015972mg
SwissprotQ9SI381e-146ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLR0HS971e-161R0HS97_9BRAS; Uncharacterized protein
STRINGAT2G14210.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.11e-139AGAMOUS-like 44